Jobs
E

Sr Software Engineer (Full-Stack | PHP | Symfony | React)

EVERSANAMH, IN23h ago
Full-timevia indeed

Required Skills

agileangularapiawsazurecassandraci/cdcsscypressdockerdynamodbgraphqlgrpcjavascriptkafkakuberneteslaravelmongodbmysqlnext.jsnosqlnuxtphpplaywrightpostgresqlrabbitmqreactrestseleniumsqlsveltetailwindtypescriptvitevuewebpack

Job Description

  • *Company Description**

At EVERSANA, we are proud to be certified as a Great Place to Work across the globe. We’re fueled by our vision to create a healthier world. How? Our global team of more than 7,000 employees is committed to creating and delivering next\-generation commercialization services to the life sciences industry. We are grounded in our cultural beliefs and serve more than 650 clients ranging from innovative biotech start\-ups to established pharmaceutical companies. Our products, services and solutions help bring innovative therapies to market and support the patients who depend on them. Our jobs, skills and talents are unique, but together we make an impact every day. Join us!

Across our growing organization, we embrace diversity in backgrounds and experiences. Improving patient lives around the world is a priority, and we need people from all backgrounds and swaths of life to help build the future of the healthcare and the life sciences industry. We believe our people make all the difference in cultivating an inclusive culture that embraces our cultural beliefs. We are deliberate and self\-reflective about the kind of team and culture we are building. We look for team members that are not only strong in their own aptitudes but also who care deeply about EVERSANA, our people, clients and most importantly, the patients we serve. We are EVERSANA.

  • *Job Description** **ESSENTIAL DUTIES AND RESPONSIBILITIES**

As a Senior Software Engineer, you will play a pivotal role in designing, developing, and delivering high\-quality software solutions while driving engineering excellence across the team. Your key responsibilities include:

  • Designing, developing, enhancing, and maintaining scalable web applications using PHP, React.js, Next.js, TypeScript, JavaScript, and RESTful APIs.
  • Building responsive, accessible, and reusable front\-end components using modern UI frameworks and libraries such as React, Next.js, Tailwind CSS, Material UI, or similar tools.
  • Developing and maintaining backend services, API integrations, and business logic using PHP frameworks such as Laravel, Symfony, CodeIgniter, or similar PHP\-based platforms.
  • Collaborating closely with product managers, designers, QA engineers, and cross\-functional teams to gather requirements and deliver scalable, reliable solutions.
  • Integrating front\-end applications with REST APIs, GraphQL services, third\-party systems, and enterprise platforms.
  • Ensuring code quality, maintainability, security, performance, and adherence to modern engineering best practices.
  • Conducting comprehensive code reviews and offering constructive technical feedback to peers.
  • Debugging, troubleshooting, and resolving complex technical issues in production and non\-production environments.
  • Working with DevOps teams to support deployment, orchestration, monitoring, and release management of cloud\-native applications.
  • Staying current with emerging technologies, industry trends, and modern web engineering practices.
  • Mentoring junior team members and contributing to a culture of technical excellence, collaboration, and continuous improvement.
  • *Qualifications** **MINIMUM KNOWLEDGE, SKILLS AND ABILITIES**

The requirements listed below are representative of the experience, education, knowledge, skill and/or abilities required.

  • Bachelor’s or Master’s degree in Computer Science, Software Engineering, Information Technology, or a related field.
  • 6\+ years of hands\-on experience as a Software Engineer building enterprise\-level web applications.
  • Strong proficiency in PHP and modern PHP development practices.
  • Hands\-on experience with PHP frameworks such as Laravel, Symfony, CodeIgniter, or similar frameworks.
  • Strong front\-end development experience with React.js and Next.js.
  • Strong knowledge of JavaScript ES6\+, TypeScript, HTML5, CSS3, and responsive web design.
  • Experience with Next.js concepts such as server\-side rendering, static site generation, routing, API routes, and performance optimization.
  • Experience with React ecosystem tools such as Redux, Redux Toolkit, Zustand, Context API, React Query / TanStack Query, or SWR.
  • Experience integrating applications with RESTful APIs and/or GraphQL services.
  • Proficiency with relational databases such as SQL Server, MySQL, PostgreSQL, or Oracle, including query optimization and data modeling.
  • Hands\-on experience with cloud platforms such as AWS, Azure, or Google Cloud and containerization tools such as Docker and Kubernetes.
  • Knowledge of observability and monitoring tools such as Splunk, AppDynamics, Prometheus, Grafana, or ELK.
  • Experience with security best practices, including OAuth2, JWT, authentication/authorization patterns, secure coding standards, and protection against common web vulnerabilities.
  • Familiarity with Agile methodologies, CI/CD pipelines, source control, and modern DevOps best practices.
  • Experience with test automation tools and frameworks such as Jest, React Testing Library, Cypress, Playwright, PHPUnit, or Selenium.
  • Strong troubleshooting, debugging, and analytical capabilities.
  • Excellent collaborative and communication skills, with experience working in cross\-functional environments.
  • Hands\-on experience with incident management processes, including creating, managing, and resolving incidents using ServiceNow or similar ITSM tools.
  • *PREFERRED QUALIFICATIONS**
  • Healthcare domain knowledge, including familiarity with terminology, workflows, regulatory needs such as HIPAA and PHI, or experience building healthcare applications.
  • Experience with similar modern front\-end frameworks such as Vue.js, Nuxt.js, Angular, Svelte, SvelteKit, Remix, or Gatsby.
  • Experience with styling and component libraries such as Tailwind CSS, Material UI, Chakra UI, Styled Components, Emotion, Shadcn/UI, or Radix UI.
  • Experience with modern front\-end build tooling and package managers such as Vite, Webpack, Babel, npm, Yarn, or pnpm.
  • Exposure to API Gateways, GraphQL, gRPC, or event\-driven integrations.
  • Familiarity with NoSQL databases such as MongoDB, Cassandra, or DynamoDB.
  • Experience working with message\-driven architectures such as Kafka, RabbitMQ, AWS SQS, or AWS SNS.
  • Understanding of distributed systems, performance optimization, caching strategies, scalability patterns, and web application security.
  • Ability to contribute to architecture discussions and technical design decisions.
  • *Additional Information** **OUR CULTURAL BELIEFS:**
  • *Patient Minded** I act with the patient’s best interest in mind.
  • *Client Delight** I own every client experience and its impact on results.
  • *Take Action** I am empowered and empower others to act now.
  • *Grow Talent** I own my development and invest in the development of others.
  • *Win Together** I passionately connect with anyone, anywhere, anytime to achieve results.
  • *Communication Matters** I speak up to create transparent, thoughtful and timely dialogue.
  • *Embrace Diversity** I create an environment of awareness and respect.
  • *Always Innovate** I am bold and creative in everything I do.

Our team is aware of recent fraudulent job offers in the market, misrepresenting EVERSANA. Recruitment fraud is a sophisticated scam commonly perpetrated through online services using fake websites, unsolicited e\-mails, or even text messages claiming to be a legitimate company. Some of these scams request personal information and even payment for training or job application fees. Please know EVERSANA would never require personal information nor payment of any kind during the employment process. We respect the personal rights of all candidates looking to explore careers at EVERSANA.

From EVERSANA’s inception, Diversity, Equity \& Inclusion have always been key to our success. We are an Equal Opportunity Employer, and our employees are people with different strengths, experiences, and backgrounds who share a passion for improving the lives of patients and leading innovation within the healthcare industry. Diversity not only includes race and gender identity, but also age, disability status, veteran status, sexual orientation, religion, and many other parts of one’s identity. All of our employees’ points of view are key to our success, and inclusion is everyone's responsibility.

Follow us on LinkedIn \| Twitter

Similar Jobs

Browse all jobs

Job Overview

Job type
Full-time
Work mode
On-site
Location
Mumbai
Posted
23h ago
Source
Indeed